Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

This Recombinant Candida albicans Altered inheritance of mitochondria protein 36, mitochondrial (AIM36) spans the amino acid sequence from region 27-292.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 36, mitochondrial, Found in mitochondria protein 39

UniProt

C4YJI1

Expression Region

27-292

Origin

Candida albicans (strain WO-1) (Yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TTTPIYHQTPMQIIKRNYVIVHRERKKEPVIRYLFYMLVASWVAIYFVANRVDKKKPPQQ SFTEREFQSYEEETGLKRRNKLISHTMNSKYKFYVIPYVHDEEELKKVANLLQHKDENAT VKIIDPAQLIEEQKKDEGMKYHYLLEDLDEQGRPYPPGLITAVIKQEIYKILNTREGTFD TNFIIKNYPQTTNEAIKFENDISDIQKCLILHYDMLNELPKNKTNEEQRAIKNVDGYFNS VGKSKTLVEKFDPMDKEFEEIMLEDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YY2 ORF Vector (Human) (pORF)
ORF036048 1.0 µg DNA

YY2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) Mouse Monoclonal Antibody
MBS439114-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

CD47 / IAP (Integrin Associated Protein) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) Mouse Monoclonal Antibody
MBS439114-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD47 / IAP (Integrin Associated Protein) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) Mouse Monoclonal Antibody
MBS439114-03 0.1 mg (Without BSA & Azide at 1mg/mL)

CD47 / IAP (Integrin Associated Protein) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) Mouse Monoclonal Antibody
MBS439114-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD47 / IAP (Integrin Associated Protein) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) Mouse Monoclonal Antibody
MBS439114-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

CD47 / IAP (Integrin Associated Protein) Mouse Monoclonal Antibody

Sign In for Pricing
View Details