Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 158 (Tmem158)

This Recombinant Mouse Transmembrane protein 158 (Tmem158) spans the amino acid sequence from region 21-286.

Product Specifications

Product Name Alternative

Transmembrane protein 158, 40 kDa BINP-binding protein, p40BBP, Ras-induced senescence protein 1

UniProt

Q6F5E0

Expression Region

21-286

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GATDAPGLAGTPPNASANASFTNEHSTPRLLASAASAPPERSGPEEAPAAPCNISVQRQM LSSLLVRWGRPRGLQCDLLLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRL CVGCGWVRGRLRAPAGAPTALPAYPAAEPGPLWLQGEPRHFCCLDFSLEELQGEPGWRLN RKPIESTLVACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQRRTTAGAPAAAPAAVPAG TTAAAAAAAAAAAAAAAAVTSGVAPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-3-aminoadipic acid
sc-327680A 1 g

Fmoc-3-aminoadipic acid

Sign In for Pricing
View Details
DCN Human, Sf9
32-13191-2 2 µg

DCN Human, Sf9

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)
MBS2169377-01 0.1 mL

Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)
MBS2169377-02 0.2 mL

Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)
MBS2169377-03 0.5 mL

Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)

Sign In for Pricing
View Details
Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)
MBS2169377-04 1 mL

Polyclonal Antibody to Fatty Acid Binding Protein 8, Myelin (FABP8)

Sign In for Pricing
View Details