Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

This Recombinant Candida albicans Altered inheritance of mitochondria protein 36, mitochondrial (AIM36) spans the amino acid sequence from region 27-292.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 36, mitochondrial, Found in mitochondria protein 39

UniProt

Q5ALN1

Expression Region

27-292

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TTTPIYHQTPMQIIKRNYVIVHRERKKEPVIRYLFYMLVASWVAIYFVANRVDKKKPPQQ SFTEREFQSYEEETGLKRRNKLISHTMNSKYKFYVIPYVHDEEELKKVANLLQHKDENAT VKIIDPAQLIEEQKKDEGMKYHYLLEDLDEQGRPYPPGLITAVIKQEIYKILNTREGTFD TNFIIKNYPQTTNEAIKFENDISDIQKCLILHYDMLNELPKNKTDEEQRAIKNVDGYFDS VGKSKTLVEKFDPMDKEFEEIMLEDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CKB Antibody
RC-6970-01 50 μL

Recombinant CKB Antibody

Sign In for Pricing
View Details
Recombinant CKB Antibody
RC-6970-02 100 µL

Recombinant CKB Antibody

Sign In for Pricing
View Details
Recombinant CKB Antibody
RC-6970-03 1 mL

Recombinant CKB Antibody

Sign In for Pricing
View Details
Phospho-PARP1 Antibody (pT368)
F48732-0.4ML 0.4 mL

Phospho-PARP1 Antibody (pT368)

Sign In for Pricing
View Details
Human GFRAL activation kit by CRISPRa
GA118053 1 Kit

Human GFRAL activation kit by CRISPRa

Sign In for Pricing
View Details
COX6B1 Recombinant Rabbit Monoclonal Antibody [JE59-16]
HA722407 100 µL

COX6B1 Recombinant Rabbit Monoclonal Antibody [JE59-16]

Sign In for Pricing
View Details