Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein ADORA3, isoform 3 (ADORA3)

This Recombinant Human Protein ADORA3, isoform 3 (ADORA3) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Protein ADORA3, isoform 3

UniProt

Q6P2N6

Expression Region

1-266

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMW LFILLSLALISDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAF SPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLA NDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILIICILITGLGIISVISHLTKRRRSQR NRRVGNTLKPFSRVLTPKEMAPTEQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GnRH-Receptor (LHRH Receptor) (GNRHR/768), CF405S conjugate, 0.1mg/mL
BNC040768-100 1x 100 µL

GnRH-Receptor (LHRH Receptor) (GNRHR/768), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Annexin A13 (ANXA13) Human Gene Knockout Kit (CRISPR)
KN415571 1 Kit

Annexin A13 (ANXA13) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ric3 Mouse Gene Knockout Kit (CRISPR)
KN514814 1 Kit

Ric3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Peroxiredoxin 5 (PRDX5) Human Gene Knockout Kit (CRISPR)
KN210709LP 1 Kit

Peroxiredoxin 5 (PRDX5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FUS2 (NAT6) Mouse Monoclonal Antibody [Clone ID: AT2F4]
AM09137PU-N 100 µL

FUS2 (NAT6) Mouse Monoclonal Antibody [Clone ID: AT2F4]

Sign In for Pricing
View Details
Unc80 Mouse Gene Knockout Kit (CRISPR)
KN518713 1 Kit

Unc80 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details