Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein ADORA3, isoform 3 (ADORA3)

This Recombinant Human Protein ADORA3, isoform 3 (ADORA3) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Protein ADORA3, isoform 3

UniProt

Q6P2N6

Expression Region

1-266

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMW LFILLSLALISDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAF SPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLA NDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILIICILITGLGIISVISHLTKRRRSQR NRRVGNTLKPFSRVLTPKEMAPTEQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 Human Gene Knockout Kit (CRISPR)
KN201231BN 1 Kit

CD7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dihydroergocristine N-Oxide
TRC-B288465-1MG 1 mg

Dihydroergocristine N-Oxide

Sign In for Pricing
View Details
4-[3-Hydroxy-6-ethyl-2-propylphenoxy]butanoic Acid Ethyl Ester
TRC-H941355-50MG 50 mg

4-[3-Hydroxy-6-ethyl-2-propylphenoxy]butanoic Acid Ethyl Ester

Sign In for Pricing
View Details
Recombinant TACR1 Antibody
RC-3069-01 50 μL

Recombinant TACR1 Antibody

Sign In for Pricing
View Details
Recombinant TACR1 Antibody
RC-3069-02 100 µL

Recombinant TACR1 Antibody

Sign In for Pricing
View Details
Recombinant TACR1 Antibody
RC-3069-03 1 mL

Recombinant TACR1 Antibody

Sign In for Pricing
View Details