Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein ADORA3, isoform 3 (ADORA3)

This Recombinant Human Protein ADORA3, isoform 3 (ADORA3) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Protein ADORA3, isoform 3

UniProt

Q6P2N6

Expression Region

1-266

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMW LFILLSLALISDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAF SPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLA NDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILIICILITGLGIISVISHLTKRRRSQR NRRVGNTLKPFSRVLTPKEMAPTEQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethylenediamine-N,N'-diacetic Acid
TRC-E900490-250MG 250 mg

Ethylenediamine-N,N'-diacetic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS628986 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Spiramycin Embonate
TRC-S682370-5G 5 g

Spiramycin Embonate

Sign In for Pricing
View Details
Slc2a9 Mouse Gene Knockout Kit (CRISPR)
KN516036 1 Kit

Slc2a9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VAP1 (AOC3) Rabbit Polyclonal Antibody
TA369453 100 µL

VAP1 (AOC3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Biological Safety Cabinet Class II BCBS-1203
BCBS-1203 1 Unit

Biological Safety Cabinet Class II BCBS-1203

Sign In for Pricing
View Details