Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein ARV1 (Arv1)

This Recombinant Mouse Protein ARV1 (Arv1) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Protein ARV1

UniProt

Q9D0U9

Expression Region

1-266

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTGGRRGTRSGKGTEGAAATSSSCLYRCIECNREAQELYRDYSHGVLKITICKSCQKPV DKYIEYDPVIILINAILCKTQAYRHILFNTKINIHGKLCMFCLLCEAYLRWWQLQDSSQS PAPDDVIRYAKEWDFYRMFVIASFEQAAFLTGIFAFLWVQQPMTAKRAPDFVLLLKALLL SSYGKLLLIPAVIWEHDYTPLCLRLIKVFVLTSNFQAVRVTLNTNRRLSLLVVLSGLLLE SIVVFFFQRMEWDVSSDCALYKSQDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN14 Antibody (C-term)
orb1931954-01 50 µL

CLDN14 Antibody (C-term)

Sign In for Pricing
View Details
CLDN14 Antibody (C-term)
orb1931954-02 100 µL

CLDN14 Antibody (C-term)

Sign In for Pricing
View Details
ANP32BP2 Protein Vector (Human) (pPM-N-D-C-HA)
PV322352 500 ng

ANP32BP2 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
TMEM16C Polyclonal Antibody
orb1420771 100 µL

TMEM16C Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human HTR3E shRNA (UAS) - Lentiviral human HTR3E shRNA (UAS, iRFP) (100)
GTR15078267 1 Vial

Lentiviral human HTR3E shRNA (UAS) - Lentiviral human HTR3E shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
T2R16 CRISPR Activation Plasmid (m)
sc-431084-ACT 20 µg

T2R16 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details