Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein ARV1 (Arv1)

This Recombinant Mouse Protein ARV1 (Arv1) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Protein ARV1

UniProt

Q9D0U9

Expression Region

1-266

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTGGRRGTRSGKGTEGAAATSSSCLYRCIECNREAQELYRDYSHGVLKITICKSCQKPV DKYIEYDPVIILINAILCKTQAYRHILFNTKINIHGKLCMFCLLCEAYLRWWQLQDSSQS PAPDDVIRYAKEWDFYRMFVIASFEQAAFLTGIFAFLWVQQPMTAKRAPDFVLLLKALLL SSYGKLLLIPAVIWEHDYTPLCLRLIKVFVLTSNFQAVRVTLNTNRRLSLLVVLSGLLLE SIVVFFFQRMEWDVSSDCALYKSQDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTP4A1 Polyclonal Antibody
E-AB-90402-01 60 µL

PTP4A1 Polyclonal Antibody

Sign In for Pricing
View Details
PTP4A1 Polyclonal Antibody
E-AB-90402-02 120 µL

PTP4A1 Polyclonal Antibody

Sign In for Pricing
View Details
PTP4A1 Polyclonal Antibody
E-AB-90402-03 200 µL

PTP4A1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC25A13 Polyclonal Antibody
E-AB-11581-01 20 µL

SLC25A13 Polyclonal Antibody

Sign In for Pricing
View Details
SLC25A13 Polyclonal Antibody
E-AB-11581-02 60 µL

SLC25A13 Polyclonal Antibody

Sign In for Pricing
View Details
SLC25A13 Polyclonal Antibody
E-AB-11581-03 120 µL

SLC25A13 Polyclonal Antibody

Sign In for Pricing
View Details