Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nectria haematococca Probable endonuclease LCL3 (LCL3)

This Recombinant Nectria haematococca Probable endonuclease LCL3 (LCL3) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Probable endonuclease LCL3, EC= 3.1.-.-

UniProt

C7YQ31

Expression Region

1-267

Origin

Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVWPFGSQSSDKGNEGKPQEQTKRSAVSWTRSLGSPDPDPFAAAKEWAPTVLFSLTGLAA LQLYANYLRRIPGAAYVRPNFFRNRSLFGRVTSVGDGDNFHFFHTPGGRAVGWGWLRKVP ESRKELRGRTIPIRIAGVDAPEGAHFGKPAQPFAAEALDWLTNYILNRNVRAYIYKRDQY ERVVATVYVRRFLFRKDVGLEMIKRGLATTYEAKSGAEFGGMKEVYEKAQAKAKRKRKGM WSGKASEFESPREYKTKWAAHDKSNSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat CD89/FCAR Protein (His Tag)
PKSR030405 100 µg

Recombinant Rat CD89/FCAR Protein (His Tag)

Sign In for Pricing
View Details
INSC Rabbit Polyclonal Antibody
TA372780 100 µL

INSC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caffeidine Acid
TRC-C080210-500MG 500 mg

Caffeidine Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Artery
CS807216 5x 5 µm

Tissue FFPE Sections, Artery

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS502533 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
DCTN1 (NM_004082) Human Over-expression Lysate
LY418225 100 µg

DCTN1 (NM_004082) Human Over-expression Lysate

Sign In for Pricing
View Details