Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nectria haematococca Probable endonuclease LCL3 (LCL3)

This Recombinant Nectria haematococca Probable endonuclease LCL3 (LCL3) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Probable endonuclease LCL3, EC= 3.1.-.-

UniProt

C7YQ31

Expression Region

1-267

Origin

Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVWPFGSQSSDKGNEGKPQEQTKRSAVSWTRSLGSPDPDPFAAAKEWAPTVLFSLTGLAA LQLYANYLRRIPGAAYVRPNFFRNRSLFGRVTSVGDGDNFHFFHTPGGRAVGWGWLRKVP ESRKELRGRTIPIRIAGVDAPEGAHFGKPAQPFAAEALDWLTNYILNRNVRAYIYKRDQY ERVVATVYVRRFLFRKDVGLEMIKRGLATTYEAKSGAEFGGMKEVYEKAQAKAKRKRKGM WSGKASEFESPREYKTKWAAHDKSNSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YBX2 Mouse Monoclonal Antibody [Clone ID: OTI3B5]
CF811254 100 µg

YBX2 Mouse Monoclonal Antibody [Clone ID: OTI3B5]

Sign In for Pricing
View Details
ZFP37 Mouse Monoclonal Antibody [Clone ID: OTI3G4]
CF810207 100 µg

ZFP37 Mouse Monoclonal Antibody [Clone ID: OTI3G4]

Sign In for Pricing
View Details
ADH5 (NM_000671) Human Recombinant Protein
TP304903L 1 mg

ADH5 (NM_000671) Human Recombinant Protein

Sign In for Pricing
View Details
5,6-Diamino-4-hydroxypyrimidine
TRC-D416380-250MG 250 mg

5,6-Diamino-4-hydroxypyrimidine

Sign In for Pricing
View Details
Cyclin D1 (CCND1/809), CF594 conjugate, 0.1mg/mL
BNC940809-100 1x 100 µL

Cyclin D1 (CCND1/809), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Amino-4-thiazoleglyoxylic Acid
TRC-A630205-5G 5 g

2-Amino-4-thiazoleglyoxylic Acid

Sign In for Pricing
View Details