Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized MscS family protein YkuT (ykuT)

This Recombinant Bacillus subtilis Uncharacterized MscS family protein YkuT (ykuT) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Uncharacterized MscS family protein YkuT

UniProt

O34897

Expression Region

1-267

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFIKQYDWAGLITNAGVLLIKLAIMILLYFIVRSLGMKIIKHLFAKFEEQNSLSIGRAH TLRSLTLNIFAYTLIFIFFVMVLDLFHYDPSALLAGAGIVGLAVGFGAQGLVSDIVTGFF ILLEKQLDVGDYITVSTFDGIVEQVGLRTTQIRSFDGTLHYIPNRNITNVSNHSRGTMQA LVDIKVPAERNIDEMIHILQQVCDETAAALPQIKEGPNVIGIQELGTSEIVIRVIAKTEN MEQWRVERVLRKEIKNAFDRAFPKETE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Air Release Properties Tester BPTL-210
BPTL-210 1 Unit

Air Release Properties Tester BPTL-210

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS806260 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
DHCR7 (NM_001360) Human Over-expression Lysate
LC419974 20 µg

DHCR7 (NM_001360) Human Over-expression Lysate

Sign In for Pricing
View Details
Ptcd3 Mouse Gene Knockout Kit (CRISPR)
KN514153 1 Kit

Ptcd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,2,3,7,8,9-Hexachlorodibenzodioxin
TRC-H290790-1MG 1 mg

1,2,3,7,8,9-Hexachlorodibenzodioxin

Sign In for Pricing
View Details
MAP2K1 Mouse Monoclonal Antibody [Clone ID: 13B6.G12]
TA396832 100 µg

MAP2K1 Mouse Monoclonal Antibody [Clone ID: 13B6.G12]

Sign In for Pricing
View Details