Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized MscS family protein YkuT (ykuT)

This Recombinant Bacillus subtilis Uncharacterized MscS family protein YkuT (ykuT) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Uncharacterized MscS family protein YkuT

UniProt

O34897

Expression Region

1-267

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFIKQYDWAGLITNAGVLLIKLAIMILLYFIVRSLGMKIIKHLFAKFEEQNSLSIGRAH TLRSLTLNIFAYTLIFIFFVMVLDLFHYDPSALLAGAGIVGLAVGFGAQGLVSDIVTGFF ILLEKQLDVGDYITVSTFDGIVEQVGLRTTQIRSFDGTLHYIPNRNITNVSNHSRGTMQA LVDIKVPAERNIDEMIHILQQVCDETAAALPQIKEGPNVIGIQELGTSEIVIRVIAKTEN MEQWRVERVLRKEIKNAFDRAFPKETE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR79 (WRAP53) Human Gene Knockout Kit (CRISPR)
KN200142RB 1 Kit

WDR79 (WRAP53) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDE4D (Ab-190/53) Antibody
8B0543-AAT 50 µg

PDE4D (Ab-190/53) Antibody

Sign In for Pricing
View Details
Benz[j]aceanthrylen-2(1H)-one13C2 and Benz[e]aceanthrylen-6(5H)-one13C2
TRC-B183542-25MG 25 mg

Benz[j]aceanthrylen-2(1H)-one13C2 and Benz[e]aceanthrylen-6(5H)-one13C2

Sign In for Pricing
View Details
Vanillin-13C6
TRC-V097503-1MG 1 mg

Vanillin-13C6

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike Protein (RBD, mFc Tag) (V367F)
PKSR030523 100 µg

Recombinant SARS-CoV-2 Spike Protein (RBD, mFc Tag) (V367F)

Sign In for Pricing
View Details
CD7 (T-Cell Leukemia Marker) (CD7/3737), CF647 conjugate, 0.1mg/mL
BNC472056-500 1x 500 µL

CD7 (T-Cell Leukemia Marker) (CD7/3737), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details