Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized MscS family protein YkuT (ykuT)

This Recombinant Bacillus subtilis Uncharacterized MscS family protein YkuT (ykuT) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Uncharacterized MscS family protein YkuT

UniProt

O34897

Expression Region

1-267

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFIKQYDWAGLITNAGVLLIKLAIMILLYFIVRSLGMKIIKHLFAKFEEQNSLSIGRAH TLRSLTLNIFAYTLIFIFFVMVLDLFHYDPSALLAGAGIVGLAVGFGAQGLVSDIVTGFF ILLEKQLDVGDYITVSTFDGIVEQVGLRTTQIRSFDGTLHYIPNRNITNVSNHSRGTMQA LVDIKVPAERNIDEMIHILQQVCDETAAALPQIKEGPNVIGIQELGTSEIVIRVIAKTEN MEQWRVERVLRKEIKNAFDRAFPKETE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac 3-Hydroxybutyric Acid-d2 Sodium Salt
TRC-H833023-10MG 10 mg

rac 3-Hydroxybutyric Acid-d2 Sodium Salt

Sign In for Pricing
View Details
Recombinant IP3 Receptor Antibody
RC-6895-01 50 μL

Recombinant IP3 Receptor Antibody

Sign In for Pricing
View Details
Recombinant IP3 Receptor Antibody
RC-6895-02 100 µL

Recombinant IP3 Receptor Antibody

Sign In for Pricing
View Details
Recombinant IP3 Receptor Antibody
RC-6895-03 1 mL

Recombinant IP3 Receptor Antibody

Sign In for Pricing
View Details
Cytidine-5-diphosphate Sodium Salt
TRC-C998323-5G 5 g

Cytidine-5-diphosphate Sodium Salt

Sign In for Pricing
View Details
CD147 (BSG/963), CF647 conjugate, 0.1mg/mL
BNC470963-500 1x 500 µL

CD147 (BSG/963), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details