Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Integral membrane protein 2C (ITM2C)

This Recombinant Human Integral membrane protein 2C (ITM2C) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Integral membrane protein 2C, Cerebral protein 14, Transmembrane protein BRI3, Cleaved into the following chain:, 1. CT-BRI3

UniProt

Q9NQX7

Expression Region

1-267

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPAREEQPPQHRSKRGGSVGGVCY LSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFRCGVLYEDSLSSQVRTQMELEEDVKI YLDENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFW ELLMNVKRGTYLPQTYIIQEEMVVTEHVSDKEALGSFIYHLCNGKDTYRLRRRATRRRIN KRGAKNCNAIRHFENTFVVETLICGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Embryo-E12 cDNA
RD-104-12 30 Reactions

Rat Embryo-E12 cDNA

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) NFUA Polyclonal Antibody
MBS7185598 Inquire

Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) NFUA Polyclonal Antibody

Sign In for Pricing
View Details
HIST2H2AA4 (H2AC19) (NM_001040874) Human Tagged ORF Clone Lentiviral Particle
RC200688L1V 200 µL

HIST2H2AA4 (H2AC19) (NM_001040874) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
At4g22217 Antibody
orb787530 2 mg

At4g22217 Antibody

Sign In for Pricing
View Details
Myotonic Dystrophy 129 CTG Genemer Control DNA; 500 ng
40-2026-04 500 ng

Myotonic Dystrophy 129 CTG Genemer Control DNA; 500 ng

Sign In for Pricing
View Details
TNK2 (Tyrosine Kinase Non-receptor Protein 2, Activated CDC42 Kinase 1, ACK1, ACK-1, ACK, p21cdc42Hs) (MaxLight 490)
134566-ML490 100 µL

TNK2 (Tyrosine Kinase Non-receptor Protein 2, Activated CDC42 Kinase 1, ACK1, ACK-1, ACK, p21cdc42Hs) (MaxLight 490)

Sign In for Pricing
View Details