Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Integral membrane protein 2C (ITM2C)

This Recombinant Human Integral membrane protein 2C (ITM2C) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Integral membrane protein 2C, Cerebral protein 14, Transmembrane protein BRI3, Cleaved into the following chain:, 1. CT-BRI3

UniProt

Q9NQX7

Expression Region

1-267

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPAREEQPPQHRSKRGGSVGGVCY LSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFRCGVLYEDSLSSQVRTQMELEEDVKI YLDENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFW ELLMNVKRGTYLPQTYIIQEEMVVTEHVSDKEALGSFIYHLCNGKDTYRLRRRATRRRIN KRGAKNCNAIRHFENTFVVETLICGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUBN siRNA (Human)
MBS8238774-01 15 nmol

CUBN siRNA (Human)

Sign In for Pricing
View Details
CUBN siRNA (Human)
MBS8238774-02 30 nmol

CUBN siRNA (Human)

Sign In for Pricing
View Details
CUBN siRNA (Human)
MBS8238774-03 5x 30 nmol

CUBN siRNA (Human)

Sign In for Pricing
View Details
Recombinant REBOV GP1 Protein, C-His
orb3056129-01 50 µg

Recombinant REBOV GP1 Protein, C-His

Sign In for Pricing
View Details
Recombinant REBOV GP1 Protein, C-His
orb3056129-02 100 µg

Recombinant REBOV GP1 Protein, C-His

Sign In for Pricing
View Details
Recombinant REBOV GP1 Protein, C-His
orb3056129-03 1 mg

Recombinant REBOV GP1 Protein, C-His

Sign In for Pricing
View Details