Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yndG (yndG)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yndG (yndG) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yndG

UniProt

O31811

Expression Region

1-268

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRQKPIYVEIEMKSDLDTLWEYTQNPSLHKEWDLRFSNITYLNSQPCEKQKFLYETRVGF GLKVSGTGETVGVFNKCSSERSSSLAFGSDHPLSLIRHGSGYWKYIQRENGKMTFLTQYQ YKTAYGLLGRWIDRLLFRPLLGWATAWSFDALRLWVEQNKHPKRFIRSAIIYVFMCLFFS LFWFYQGFAGVKTSILTGTAEIGLAILWLLPLKRKWIIHGVQACIFAGFACLGSEIFMWV LLSVFSAASGALSLQLPSARRTKRKRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 (Melanoma Marker) (SOX10/2311R), CF740 conjugate, 0.1mg/mL
BNC742311-100 1x 100 µL

SOX10 (Melanoma Marker) (SOX10/2311R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/2750R), CF568 conjugate, 0.1mg/mL
BNC682750-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/2750R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD1 (PDCD1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7B4]
TA807995AM 100 µL

PD1 (PDCD1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7B4]

Sign In for Pricing
View Details
TMIE (NM_147196) Human Recombinant Protein
TP320050 20 µg

TMIE (NM_147196) Human Recombinant Protein

Sign In for Pricing
View Details
FLVCR2 (NM_001195283) Human Over-expression Lysate
LC434160 20 µg

FLVCR2 (NM_001195283) Human Over-expression Lysate

Sign In for Pricing
View Details
1-(4-Chlorophenyl)-7-oxo-6-[4-(2-oxopiperidin-1-yl)phenyl]-4,5-dihydropyrazolo[3,4-c]pyridine-3-carboxamide
TRC-C429390-1MG 1 mg

1-(4-Chlorophenyl)-7-oxo-6-[4-(2-oxopiperidin-1-yl)phenyl]-4,5-dihydropyrazolo[3,4-c]pyridine-3-carboxamide

Sign In for Pricing
View Details