Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU131 (UU131)

This Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU131 (UU131) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Uncharacterized protein UU131

UniProt

Q9PR13

Expression Region

1-268

Origin

Ureaplasma parvum serovar 3 (strain ATCC 700970)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQIKMNKSFAEFSKLPKIKQVFTPWFIAALVIFIVGLTIAFTMVGLLNEGFENARALVN DQGQIIGKVADVSGDNHSLMSWLGYDQHANYQELYKTIHDQLINGKTMESLINNTNKNND PKLYEALHYHAHSKFINHNGTWGFVTKVLSDWENSWFYKYNQLFSQLANSQNPVLAAQGI KSLAKLSTIIQYQNPNYIAYNWVFIVFMMPQMITFIIIVVKLATVFSPKKSAEEKQAYKL AKLEVKNQKKAKKLNNSLQQINLNLEAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ASGR2/ASGPR2 Monoclonal Antibody
AN300272P-01 20 µL

Recombinant ASGR2/ASGPR2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant ASGR2/ASGPR2 Monoclonal Antibody
AN300272P-02 100 µL

Recombinant ASGR2/ASGPR2 Monoclonal Antibody

Sign In for Pricing
View Details
D-Glucosyl-beta-1,1′-N-nervonoyl-D-erythro-sphingosine
TRC-D272135-25MG 25 mg

D-Glucosyl-beta-1,1′-N-nervonoyl-D-erythro-sphingosine

Sign In for Pricing
View Details
Tesk1 Mouse Gene Knockout Kit (CRISPR)
KN517419 1 Kit

Tesk1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Brilliant Thallium Gold Snapshot Pioneer
11021-2 2 Plates

Brilliant Thallium Gold Snapshot Pioneer

Sign In for Pricing
View Details
SMAD2 Rabbit Polyclonal Antibody
TA392666 100 µL

SMAD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details