Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Integral membrane protein 2C (Itm2c)

This Recombinant Rat Integral membrane protein 2C (Itm2c) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Integral membrane protein 2C, Cleaved into the following chain:, 1. CT-BRI3

UniProt

Q5PQL7

Expression Region

1-269

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKISFQPAVAGVKAEKADKAAASGPASASAPAAEILLTPAREERPPRHRSRKGGSVGGV CYLSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFHCGVLYEDSLSSQIRTRLELEEDV KIYLEENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRN FWELLMNVKRGTYLPQTYIIQEEMVVTEHVRDKEALGSFIYHLCNGKDTYRLRRRATRRR INKRGAKNCNAIRHFENTFVVETLICGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD1, Mouse (RMP1-14), CF405S conjugate, 0.1mg/mL
BNC042002-100 1x 100 µL

PD1, Mouse (RMP1-14), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(3S,5R)-6-Cyano-3,5-dihydroxy-hexanoic Acid tert-Butyl Ester
TRC-C955900-5MG 5 mg

(3S,5R)-6-Cyano-3,5-dihydroxy-hexanoic Acid tert-Butyl Ester

Sign In for Pricing
View Details
CD8A Mouse Monoclonal Antibody [Clone ID: B-Z31]
AM31251PU-N 2 mL (200 Tests)

CD8A Mouse Monoclonal Antibody [Clone ID: B-Z31]

Sign In for Pricing
View Details
Human NDUFS7 activation kit by CRISPRa
GA117757 1 Kit

Human NDUFS7 activation kit by CRISPRa

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD3ε Antibody
RD21242F-01 25 µg

PE/Cyanine7 Anti-Mouse CD3ε Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD3ε Antibody
RD21242F-02 100 µg

PE/Cyanine7 Anti-Mouse CD3ε Antibody

Sign In for Pricing
View Details