Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Signal recognition particle receptor subunit beta (Srprb)

This Recombinant Rat Signal recognition particle receptor subunit beta (Srprb) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Signal recognition particle receptor subunit beta, SR-beta

UniProt

Q4FZX7

Expression Region

1-269

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVAVLAVLLTLVFWKFIWSRKS SQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHE SLRLQFLDRFKSSARAVVFVVDSATFQREVKDVAEFLYQVLIDSMALKNTPAFLVACNKQ DIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVE FLECSAKGGRGDAGSADVQDLEKWLAKIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fndc8 (NM_030224) Mouse Tagged ORF Clone
MR220647 10 µg

Fndc8 (NM_030224) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
DIMT1L (DIMT1) Human shRNA Lentiviral Particle (Locus ID 27292)
TL315680V 500 µL Each

DIMT1L (DIMT1) Human shRNA Lentiviral Particle (Locus ID 27292)

Sign In for Pricing
View Details
Anti-YB1 YBX1 Rabbit Monoclonal Antibody
M01054 100 µL/Vial

Anti-YB1 YBX1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
COVID-19 TaqMan RT-PCR Kit (E/RdRP genes) -500p
TM67200 500 Reactions

COVID-19 TaqMan RT-PCR Kit (E/RdRP genes) -500p

Sign In for Pricing
View Details
SERPINA6 Polyclonal Antibody
A71463-100 100 µL

SERPINA6 Polyclonal Antibody

Sign In for Pricing
View Details
Rack1 Mouse shRNA Plasmid (Locus ID 14694)
TR515617 1 Kit

Rack1 Mouse shRNA Plasmid (Locus ID 14694)

Sign In for Pricing
View Details