Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Signal recognition particle receptor subunit beta (Srprb)

This Recombinant Rat Signal recognition particle receptor subunit beta (Srprb) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Signal recognition particle receptor subunit beta, SR-beta

UniProt

Q4FZX7

Expression Region

1-269

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVAVLAVLLTLVFWKFIWSRKS SQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHE SLRLQFLDRFKSSARAVVFVVDSATFQREVKDVAEFLYQVLIDSMALKNTPAFLVACNKQ DIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVE FLECSAKGGRGDAGSADVQDLEKWLAKIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Triticum aestivum Photosystem Q(B) protein
MBS7027269-01 0.02 mg

Recombinant Triticum aestivum Photosystem Q(B) protein

Sign In for Pricing
View Details
Recombinant Triticum aestivum Photosystem Q(B) protein
MBS7027269-02 0.1 mg

Recombinant Triticum aestivum Photosystem Q(B) protein

Sign In for Pricing
View Details
Recombinant Triticum aestivum Photosystem Q(B) protein
MBS7027269-03 5x 0.1 mg

Recombinant Triticum aestivum Photosystem Q(B) protein

Sign In for Pricing
View Details
Cytomegalovirus, Human, p65 IE (Immediate Early) (CMV) (MaxLight 750) discontinued
C9100-15A-ML750 100 µL

Cytomegalovirus, Human, p65 IE (Immediate Early) (CMV) (MaxLight 750) discontinued

Sign In for Pricing
View Details
IKK alpha + IKK beta Antibody (YA349, Rabbit)
HY-P80414-01 10 µL

IKK alpha + IKK beta Antibody (YA349, Rabbit)

Sign In for Pricing
View Details
IKK alpha + IKK beta Antibody (YA349, Rabbit)
HY-P80414-02 50 μL

IKK alpha + IKK beta Antibody (YA349, Rabbit)

Sign In for Pricing
View Details