Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein FLJ39653

This Recombinant Human Uncharacterized protein FLJ39653 spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Uncharacterized protein FLJ39653

UniProt

Q8N8D0

Expression Region

1-269

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQPGCAVPQSGRLRGSSRGPGRSGPGMAAAGGGSAVEPRRGGRHHRCPQSARCPAVRSGP LLQTRCPECAGAARQVLALLARPRRRGPGSRSPTPTSAGPACPLFWFHLFCIFMLACYIP WPLSVLWQFPKHLGKKELGQLHNRWGRAGEGPRPDRQSFKGWRAGGLSTLSFGTGVRRQP LATTVSLLCRFTWGWTSPFQLWRVTPQRAWCRDHHQLGRWERRCPRLGEGGNLFPAPQVI VARSGEGTVVPRFPVCQLRDSAVLLCLFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human soluble tumor necrosis factor-related apoptosis inducing ligand, sTRAIL ELISA Kit
NB-E10105-01 96 Well

Human soluble tumor necrosis factor-related apoptosis inducing ligand, sTRAIL ELISA Kit

Sign In for Pricing
View Details
Human soluble tumor necrosis factor-related apoptosis inducing ligand, sTRAIL ELISA Kit
NB-E10105-02 96 Well

Human soluble tumor necrosis factor-related apoptosis inducing ligand, sTRAIL ELISA Kit

Sign In for Pricing
View Details
Separase Blocking Peptide
MBS9619692-01 1 mg

Separase Blocking Peptide

Sign In for Pricing
View Details
Separase Blocking Peptide
MBS9619692-02 5x 1 mg

Separase Blocking Peptide

Sign In for Pricing
View Details
5-oxoprolinase (OPLAH) Mouse ELISA Kit
B1139 96 Tests

5-oxoprolinase (OPLAH) Mouse ELISA Kit

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Neurofilament, Light Polypeptide (NEFL)
MBS2073856-01 1 mL

APC/CY7-Linked Polyclonal Antibody to Neurofilament, Light Polypeptide (NEFL)

Sign In for Pricing
View Details