Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein FLJ39653

This Recombinant Human Uncharacterized protein FLJ39653 spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Uncharacterized protein FLJ39653

UniProt

Q8N8D0

Expression Region

1-269

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQPGCAVPQSGRLRGSSRGPGRSGPGMAAAGGGSAVEPRRGGRHHRCPQSARCPAVRSGP LLQTRCPECAGAARQVLALLARPRRRGPGSRSPTPTSAGPACPLFWFHLFCIFMLACYIP WPLSVLWQFPKHLGKKELGQLHNRWGRAGEGPRPDRQSFKGWRAGGLSTLSFGTGVRRQP LATTVSLLCRFTWGWTSPFQLWRVTPQRAWCRDHHQLGRWERRCPRLGEGGNLFPAPQVI VARSGEGTVVPRFPVCQLRDSAVLLCLFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPCAT1 Knockout Raji Polyclonal Cells
ARG1298 1 Million

LPCAT1 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
RhoGDI Rabbit Monoclonal Antibody
orb865998 100 µL

RhoGDI Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CLDN18 Antibody (FITC)
orb752442-01 50 μL

CLDN18 Antibody (FITC)

Sign In for Pricing
View Details
CLDN18 Antibody (FITC)
orb752442-02 100 µL

CLDN18 Antibody (FITC)

Sign In for Pricing
View Details
Anti-Mouse IgM Monoclonal Antibody (AF488 Conjugated) [RMM-1]
MBS2559390-01 0.025 mg

Anti-Mouse IgM Monoclonal Antibody (AF488 Conjugated) [RMM-1]

Sign In for Pricing
View Details
Anti-Mouse IgM Monoclonal Antibody (AF488 Conjugated) [RMM-1]
MBS2559390-02 0.1 mg

Anti-Mouse IgM Monoclonal Antibody (AF488 Conjugated) [RMM-1]

Sign In for Pricing
View Details