Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized SURF1-like protein Mb2259 (Mb2259)

This Recombinant Uncharacterized SURF1-like protein Mb2259 (Mb2259) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Uncharacterized SURF1-like protein Mb2259

UniProt

P66884

Expression Region

1-271

Origin

Mycobacterium bovis

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRLAFLLRPGWLALALVVVAFTYLCFTVLAPWQLGKNAKTSRENQQIRYSLDTPPVPLK TLLPQQDSSAPDAQWRRVTATGQYLPDVQVLARLRVVEGDQAFEVLAPFVVDGGPTVLVD RGYVRPQVGSHVPPIPRLPVQTVTITARLRDSEPSVAGKDPFVRDGFQQVYSINTGQVAA LTGVQLAGSYLQLIEDQPGGLGVLGVPHLDPGPFLSYGIQWISFGILAPIGLGYFAYAEI RARRREKAGSPPPDKPMTVEQKLADRYGRRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Alpha-1-syntrophin (SNTA1) ELISA Kit
MBS280509-01 48 Tests

Rabbit Alpha-1-syntrophin (SNTA1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Alpha-1-syntrophin (SNTA1) ELISA Kit
MBS280509-02 96 Tests

Rabbit Alpha-1-syntrophin (SNTA1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Alpha-1-syntrophin (SNTA1) ELISA Kit
MBS280509-03 5x 96 Tests

Rabbit Alpha-1-syntrophin (SNTA1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Alpha-1-syntrophin (SNTA1) ELISA Kit
MBS280509-04 10x 96 Tests

Rabbit Alpha-1-syntrophin (SNTA1) ELISA Kit

Sign In for Pricing
View Details
Phosphoenolpyruvate Carboxykinase 1, Soluble (PCK1) Antibody
abx121655-01 30 µL

Phosphoenolpyruvate Carboxykinase 1, Soluble (PCK1) Antibody

Sign In for Pricing
View Details
Phosphoenolpyruvate Carboxykinase 1, Soluble (PCK1) Antibody
abx121655-02 100 µL

Phosphoenolpyruvate Carboxykinase 1, Soluble (PCK1) Antibody

Sign In for Pricing
View Details