Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized SURF1-like protein Mb2259 (Mb2259)

This Recombinant Uncharacterized SURF1-like protein Mb2259 (Mb2259) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Uncharacterized SURF1-like protein Mb2259

UniProt

P66884

Expression Region

1-271

Origin

Mycobacterium bovis

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRLAFLLRPGWLALALVVVAFTYLCFTVLAPWQLGKNAKTSRENQQIRYSLDTPPVPLK TLLPQQDSSAPDAQWRRVTATGQYLPDVQVLARLRVVEGDQAFEVLAPFVVDGGPTVLVD RGYVRPQVGSHVPPIPRLPVQTVTITARLRDSEPSVAGKDPFVRDGFQQVYSINTGQVAA LTGVQLAGSYLQLIEDQPGGLGVLGVPHLDPGPFLSYGIQWISFGILAPIGLGYFAYAEI RARRREKAGSPPPDKPMTVEQKLADRYGRRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA5 ELISA Kit (Human)
OKEH02392-96W 96 Tests

GATA5 ELISA Kit (Human)

Sign In for Pricing
View Details
Mature Macrophage Marker antibody (biotin)
61R-1470 100 ug

Mature Macrophage Marker antibody (biotin)

Sign In for Pricing
View Details
SFXN4 Polyclonal Antibody, Biotin Conjugated
A65437-050 50 µL

SFXN4 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
PerfectMembrane-Medium, PVDF, Fluor, 100 sheets
B303-100 100 Membranes

PerfectMembrane-Medium, PVDF, Fluor, 100 sheets

Sign In for Pricing
View Details
Ethyl 2- (3- (difluoromethyl) -4-methylphenyl) -2-oxoacetate
PC1014090-01 250 mg

Ethyl 2- (3- (difluoromethyl) -4-methylphenyl) -2-oxoacetate

Sign In for Pricing
View Details
Ethyl 2- (3- (difluoromethyl) -4-methylphenyl) -2-oxoacetate
PC1014090-02 500 mg

Ethyl 2- (3- (difluoromethyl) -4-methylphenyl) -2-oxoacetate

Sign In for Pricing
View Details