Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized SURF1-like protein Mb2259 (Mb2259)

This Recombinant Uncharacterized SURF1-like protein Mb2259 (Mb2259) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Uncharacterized SURF1-like protein Mb2259

UniProt

P66884

Expression Region

1-271

Origin

Mycobacterium bovis

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRLAFLLRPGWLALALVVVAFTYLCFTVLAPWQLGKNAKTSRENQQIRYSLDTPPVPLK TLLPQQDSSAPDAQWRRVTATGQYLPDVQVLARLRVVEGDQAFEVLAPFVVDGGPTVLVD RGYVRPQVGSHVPPIPRLPVQTVTITARLRDSEPSVAGKDPFVRDGFQQVYSINTGQVAA LTGVQLAGSYLQLIEDQPGGLGVLGVPHLDPGPFLSYGIQWISFGILAPIGLGYFAYAEI RARRREKAGSPPPDKPMTVEQKLADRYGRRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLGA5 Antibody
MBS9217069-01 0.05 mL

GOLGA5 Antibody

Sign In for Pricing
View Details
GOLGA5 Antibody
MBS9217069-02 0.2 mL

GOLGA5 Antibody

Sign In for Pricing
View Details
GOLGA5 Antibody
MBS9217069-03 5x 0.2 mL

GOLGA5 Antibody

Sign In for Pricing
View Details
PDIA5 Rabbit Polyclonal Antibody (Fluoro647)
orb3096885 100 µg

PDIA5 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
FRA1L sgRNA CRISPR Lentivector (Human) (Target 2)
K0801603 1.0 µg DNA

FRA1L sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
RGD1561237 3'UTR Luciferase Stable Cell Line
TU218355 1.0 mL

RGD1561237 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details