Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aquifex aeolicus Uncharacterized protein aq_aa23 (aq_aa23)

This Recombinant Aquifex aeolicus Uncharacterized protein aq_aa23 (aq_aa23) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Uncharacterized protein aq_aa23

UniProt

O66414

Expression Region

1-271

Origin

Aquifex aeolicus (strain VF5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSKELTKEVLNLFQTLPEFYFEHFHEYGIWFPIVVGIIASAVGMFGMLLFYAAEPDTEF EKLPFFVRKIASREGDEDTYFALGIYPIIILPAEGKIIKAAAIHEFFHVLFKFPWVIFQP VTGIFMTQLPYRFFNMLTQFLYTVLPKHIVLMLILLSMPILKKFGMEKSQVYELLSLASK YITFVYICALAAVIEELLVNIATAIYFLITFKFNENTFLVTVGSSLTYLSNIPMIFACMW MDFHYADGQGVEMAKKFIELVFKTELSSLFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-100 1x 100 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF568 conjugate, 0.1mg/mL
BNC680810-100 1x 100 µL

AFP (Alpha Fetoprotein) (C2 + C3 + MBS-12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-500 1x 500 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF594 conjugate, 0.1mg/mL
BNC941897-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF405S conjugate, 0.1mg/mL
BNC042957-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), CF647 conjugate, 0.1mg/mL
BNC470396-100 1x 100 µL

Ep-CAM / CD326 (323/A3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details