Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 189 (Tmem189)

This Recombinant Mouse Transmembrane protein 189 (Tmem189) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Transmembrane protein 189

UniProt

Q99LQ7

Expression Region

1-271

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGAEDAPGRQPELDEDETAEGRRWGAQHAGARELAALYSPGKRFQEWCSVILCFSLIAH NLVHLLLLARWEHTPLVILGVVAGALVADFLSGLVHWGADTWGSVDLPIVGKAFIRPFRE HHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTQSPETLEQLYPWECFVFCLTIFG TFTNQIHKWSHTYLGLPYWVTVLQDWHVILPRKHHRIHHVAPHETYFCITTGWLNYPLEV IGFWRRLEDLIQGLTGEKPRADDMKWAQKIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF5A Protein, Human, Recombinant (His)
TMPY-04108-01 5 µg

EIF5A Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
EIF5A Protein, Human, Recombinant (His)
TMPY-04108-02 10 µg

EIF5A Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
EIF5A Protein, Human, Recombinant (His)
TMPY-04108-03 20 µg

EIF5A Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
EIF5A Protein, Human, Recombinant (His)
TMPY-04108-04 50 µg

EIF5A Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
EIF5A Protein, Human, Recombinant (His)
TMPY-04108-05 100 µg

EIF5A Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Mouse Monoclonal MMP-7 Antibody (MM0022-4C21) [DyLight 550]
NB110-60988R 0.1 mL

Mouse Monoclonal MMP-7 Antibody (MM0022-4C21) [DyLight 550]

Sign In for Pricing
View Details