Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein ARV1 (ARV1)

This Recombinant Human Protein ARV1 (ARV1) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Protein ARV1, hARV1

UniProt

Q9H2C2

Expression Region

1-271

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNGGRSGLQQGKGNVDGVAATPTAASASCQYRCIECNQEAKELYRDYNHGVLKITICKS CQKPVDKYIEYDPVIILINAILCKAQAYRHILFNTQINIHGKLCIFCLLCEAYLRWWQLQ DSNQNTAPDDLIRYAKEWDFYRMFAIAALEQTAYFIGIFTFLWVERPMTAKKKPNFILLL KALLLSSYGKLLLIPAVIWEHDYTSVCLKLIKVFVLTSNFQAIRVTLNINRKLSFLAVLS GLLLESIMVYFFQSMEWDVGSDYAIFKSQDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hao1 (NM_010403) Mouse Tagged ORF Clone
MG225007 10 µg

Hao1 (NM_010403) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse BAFF Matched Antibody Pair Set [ABP-S-021161]
ABP-S-021161 5 Plates

Mouse BAFF Matched Antibody Pair Set [ABP-S-021161]

Sign In for Pricing
View Details
RCC2P4 Protein Vector (Human) (pPM-C-HA)
PV115344 500 ng

RCC2P4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
NEK6 Rabbit Monoclonal Antibody [Clone ID: 24GB755]
TA425011 100 µL

NEK6 Rabbit Monoclonal Antibody [Clone ID: 24GB755]

Sign In for Pricing
View Details
AN-12-H5 intermediate-1
HY-22055B-01 25 mg

AN-12-H5 intermediate-1

Sign In for Pricing
View Details
AN-12-H5 intermediate-1
HY-22055B-02 10 mM - 1 mL

AN-12-H5 intermediate-1

Sign In for Pricing
View Details