Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signal recognition particle receptor subunit beta (SRPRB)

This Recombinant Human Signal recognition particle receptor subunit beta (SRPRB) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Signal recognition particle receptor subunit beta, SR-beta, Protein APMCF1

UniProt

Q9Y5M8

Expression Region

1-271

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSR RSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPG HESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACN KQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLK VEFLECSAKGGRGDVGSADIQDLEKWLAKIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flame Photometer BLFP-502
BLFP-502 1 Unit

Flame Photometer BLFP-502

Sign In for Pricing
View Details
TMPRSS12 (N-term) Rabbit Polyclonal Antibody
AP54299PU-N 400 µL

TMPRSS12 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF174 Antibody
8C11098-AAT 50 µg

ZNF174 Antibody

Sign In for Pricing
View Details
OPA1 Rabbit Monoclonal Antibody [Clone ID: OTIR3D5]
TA591063 100 µL

OPA1 Rabbit Monoclonal Antibody [Clone ID: OTIR3D5]

Sign In for Pricing
View Details
CHCHD10 Mouse Monoclonal Antibody [Clone ID: OTI3B8]
CF811798 100 µg

CHCHD10 Mouse Monoclonal Antibody [Clone ID: OTI3B8]

Sign In for Pricing
View Details
Raltitrexed
TRC-R100500-25MG 25 mg

Raltitrexed

Sign In for Pricing
View Details