Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signal recognition particle receptor subunit beta (SRPRB)

This Recombinant Human Signal recognition particle receptor subunit beta (SRPRB) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Signal recognition particle receptor subunit beta, SR-beta, Protein APMCF1

UniProt

Q9Y5M8

Expression Region

1-271

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSR RSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPG HESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACN KQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLK VEFLECSAKGGRGDVGSADIQDLEKWLAKIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Prostate
CB527390 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
OS9 (NM_006812) Human Over-expression Lysate
LC402037 20 µg

OS9 (NM_006812) Human Over-expression Lysate

Sign In for Pricing
View Details
1,5-Diazabicyclo[4.3.0]non-5-ene
TRC-D417140-5G 5 g

1,5-Diazabicyclo[4.3.0]non-5-ene

Sign In for Pricing
View Details
Human ASAH3L (ACER2) activation kit by CRISPRa
GA117482 1 Kit

Human ASAH3L (ACER2) activation kit by CRISPRa

Sign In for Pricing
View Details
TMEM221 (NM_001190844) Human Recombinant Protein
TP331134 20 µg

TMEM221 (NM_001190844) Human Recombinant Protein

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF594 conjugate, 0.1mg/mL
BNC942026-100 1x 100 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details