Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signal recognition particle receptor subunit beta (SRPRB)

This Recombinant Human Signal recognition particle receptor subunit beta (SRPRB) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Signal recognition particle receptor subunit beta, SR-beta, Protein APMCF1

UniProt

Q9Y5M8

Expression Region

1-271

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSR RSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPG HESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACN KQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLK VEFLECSAKGGRGDVGSADIQDLEKWLAKIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF488A conjugate, 0.1mg/mL
BNC881982-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smg9 Mouse Gene Knockout Kit (CRISPR)
KN516315 1 Kit

Smg9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD8 (C8/468), CF488A conjugate, 0.1mg/mL
BNC880468-500 1x 500 µL

CD8 (C8/468), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
YY1 associated factor 2 (YAF2) (NM_005748) Human Recombinant Protein
TP314071L 1 mg

YY1 associated factor 2 (YAF2) (NM_005748) Human Recombinant Protein

Sign In for Pricing
View Details
Dipentyl Carbonate
TRC-D489655-250MG 250 mg

Dipentyl Carbonate

Sign In for Pricing
View Details
Recombinant BECN1 Antibody
RC-6952-01 50 μL

Recombinant BECN1 Antibody

Sign In for Pricing
View Details