Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Integral membrane protein 2C (ITM2C)

This Recombinant Bovine Integral membrane protein 2C (ITM2C) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Integral membrane protein 2C, Cleaved into the following chain:, 1. CT-BRI3

UniProt

A2VDN0

Expression Region

1-271

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKISFQPAVAGIKGDKADKASASASASAPAPTPAAEILLTPAREERPPYQRYKKGGSVG GVCYLSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFHCGVLYEDSLSSQAHTRMELEE DVKIYLEENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPP RNFWELLMNVKRGTYLPQTYIIQEEMVVTEHVSDKEALGSFIYHLCSGKDTYRLRRRATR RRINKREAKNCNAIRHFENTFVVETLICGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Midkine (MK) ELISA Kit
MBS2600699-01 48 Well

Rabbit Midkine (MK) ELISA Kit

Sign In for Pricing
View Details
Rabbit Midkine (MK) ELISA Kit
MBS2600699-02 96 Well

Rabbit Midkine (MK) ELISA Kit

Sign In for Pricing
View Details
Rabbit Midkine (MK) ELISA Kit
MBS2600699-03 5x 96 Well

Rabbit Midkine (MK) ELISA Kit

Sign In for Pricing
View Details
Rabbit Midkine (MK) ELISA Kit
MBS2600699-04 10x 96 Well

Rabbit Midkine (MK) ELISA Kit

Sign In for Pricing
View Details
Rabbit N-terminal pro-brain natriuretic peptide ELISA Kit
GTR10418942 96 Well

Rabbit N-terminal pro-brain natriuretic peptide ELISA Kit

Sign In for Pricing
View Details
CCL15 Rabbit Polyclonal Antibody (APC)
orb2586900 100 µg

CCL15 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details