Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 178 (TMEM178)

This Recombinant Human Transmembrane protein 178 (TMEM178) spans the amino acid sequence from region 26-297.

Product Specifications

Product Name Alternative

Transmembrane protein 178

UniProt

Q8NBL3

Expression Region

26-297

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRA DPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCTAIKYH FSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEESL TQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSL GFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC Conjugated Goat Affinity Purified Antibody to Swine IgG
RAF-471-1 1 mL

TRITC Conjugated Goat Affinity Purified Antibody to Swine IgG

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF568 conjugate, 0.1mg/mL
BNC683048-500 1x 500 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Beta (TNFb) ELISA Kit
RD-TNFb-Mu-01 96 Tests

Mouse Tumor Necrosis Factor Beta (TNFb) ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Beta (TNFb) ELISA Kit
RD-TNFb-Mu-02 48 Tests

Mouse Tumor Necrosis Factor Beta (TNFb) ELISA Kit

Sign In for Pricing
View Details
EPG5 Human Gene Knockout Kit (CRISPR)
KN419254 1 Kit

EPG5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701851 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details