Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 178 (TMEM178)

This Recombinant Human Transmembrane protein 178 (TMEM178) spans the amino acid sequence from region 26-297.

Product Specifications

Product Name Alternative

Transmembrane protein 178

UniProt

Q8NBL3

Expression Region

26-297

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRA DPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCTAIKYH FSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEESL TQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSL GFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XFD405 amine
70012-AAT 1 mg

XFD405 amine

Sign In for Pricing
View Details
ERK1 (MAPK3) Human Gene Knockout Kit (CRISPR)
KN204196RB 1 Kit

ERK1 (MAPK3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS808312 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details
VIC Dye qPCR Calibration Plate *Optimized for ABI7500 Fast 96-Well*
67002-AAT 1 Plate

VIC Dye qPCR Calibration Plate *Optimized for ABI7500 Fast 96-Well*

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF405S conjugate, 0.1mg/mL
BNC042055-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Monohexyl Phthalate
TRC-M546480-1G 1 g

Monohexyl Phthalate

Sign In for Pricing
View Details