Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cholesterol 25-hydroxylase (CH25H)

This Recombinant Human Cholesterol 25-hydroxylase (CH25H) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Cholesterol 25-hydroxylase, EC= 1.14.99.38, Cholesterol 25-monooxygenase, h25OH

UniProt

O95992

Expression Region

1-272

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDI LCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPE LLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELF SLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHD LHHSHFNCNFAPYFTHWDKILGTLRTASVPAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDON Antibody
KC-3617-01 50 μL

CDON Antibody

Sign In for Pricing
View Details
CDON Antibody
KC-3617-02 100 µL

CDON Antibody

Sign In for Pricing
View Details
CDON Antibody
KC-3617-03 1 mL

CDON Antibody

Sign In for Pricing
View Details
DCUN1D4 (NM_001040402) Human Over-expression Lysate
LC421741 20 µg

DCUN1D4 (NM_001040402) Human Over-expression Lysate

Sign In for Pricing
View Details
TRK fused gene (TFG) (NM_006070) Human Over-expression Lysate
LY401827 100 µg

TRK fused gene (TFG) (NM_006070) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIB3 (NM_021158) Human Over-expression Lysate
LC402848 20 µg

TRIB3 (NM_021158) Human Over-expression Lysate

Sign In for Pricing
View Details