Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cholesterol 25-hydroxylase (CH25H)

This Recombinant Human Cholesterol 25-hydroxylase (CH25H) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Cholesterol 25-hydroxylase, EC= 1.14.99.38, Cholesterol 25-monooxygenase, h25OH

UniProt

O95992

Expression Region

1-272

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDI LCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPE LLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELF SLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHD LHHSHFNCNFAPYFTHWDKILGTLRTASVPAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nrip2 (BC094230) Mouse Tagged ORF Clone
MG200595 10 µg

Nrip2 (BC094230) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human C1orf33 (MRTO4) activation kit by CRISPRa
GA109610 1 Kit

Human C1orf33 (MRTO4) activation kit by CRISPRa

Sign In for Pricing
View Details
beta Arrestin 1 (ARRB1) Human Knockdown Lysate
LY300056 100 µg

beta Arrestin 1 (ARRB1) Human Knockdown Lysate

Sign In for Pricing
View Details
Human FAM131A activation kit by CRISPRa
GA115144 1 Kit

Human FAM131A activation kit by CRISPRa

Sign In for Pricing
View Details
MPP2 (NM_001278374) Human Tagged ORF Clone
RG238077 10 µg

MPP2 (NM_001278374) Human Tagged ORF Clone

Sign In for Pricing
View Details
EIF4E Antibody
F40229-0.08ML 0.08 mL

EIF4E Antibody

Sign In for Pricing
View Details