Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium sp. Uncharacterized protein y4jE (NGR_a03110)

This Recombinant Rhizobium sp. Uncharacterized protein y4jE (NGR_a03110) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Uncharacterized protein y4jE

UniProt

P55505

Expression Region

1-273

Origin

Rhizobium sp. (strain NGR234)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRPAVSYDELDEYLRGDGHNDYVGVSAIDGLIAAVVAGPVTILPDIWLPHVFGGSMPQA RPGSIEERLVNTVLNRHDEVESLLRDAPGHYYPIFMNHKGKTIVGPWAIGFSLGLSLGGE AWAPIAGNAKASDLPHHGRQSAAGQTAHPAFSSGAAEIESNRSSSHHIRSPAVARHHKTG PITTQPPAQTQPYRKTACSLRLQCTRSVEHDTQARGGPCIPGVSGLKLGLRPADRWSGCR WEHVVAYLGSPLYESTSTCAEGADRQLLVLRED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-100 1x 100 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-100 1x 100 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF488A conjugate, 0.1mg/mL
BNC882075-500 1x 500 µL

MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF640R conjugate, 0.1mg/mL
BNC402055-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details