Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inclusion membrane protein A (incA)

This Recombinant Inclusion membrane protein A (incA) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Inclusion membrane protein A

UniProt

O69196

Expression Region

1-273

Origin

Chlamydia trachomatis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTPTLIVTPPSPPAPSYSANRVPQPSLMDKIKKIAAIASLILIGTIGFLALLGHLVGFL IAPQITIVLLALFITSLAGNALYLQKTANLHLYQDLQREVGSLKEINFMLSVLQKEFLHL SKEFATTSKDLSAVSQDFYSCLQGFRDNYKGFESLLDEYKNSTEEMRKLFSQEIIADLKS SVASLREEIRFLTPLAEEVRRLAHNRESLTAAIEELKTIRDSLRDEIGQLSQLSRTLTSQ IALQRKESSDLCSQIRETLSSPRKSASPSTKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMP2 (NM_002294) Human Recombinant Protein
TP321216L 1 mg

LAMP2 (NM_002294) Human Recombinant Protein

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD105 Antibody[MJ7/18]
E-AB-F12330-01 100 µg

AF/LE Purified Anti-Mouse CD105 Antibody[MJ7/18]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD105 Antibody[MJ7/18]
E-AB-F12330-02 1 mg

AF/LE Purified Anti-Mouse CD105 Antibody[MJ7/18]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD105 Antibody[MJ7/18]
E-AB-F12330-03 5 mg

AF/LE Purified Anti-Mouse CD105 Antibody[MJ7/18]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD105 Antibody[MJ7/18]
E-AB-F12330-04 25 mg

AF/LE Purified Anti-Mouse CD105 Antibody[MJ7/18]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD105 Antibody[MJ7/18]
E-AB-F12330-05 50 mg

AF/LE Purified Anti-Mouse CD105 Antibody[MJ7/18]

Sign In for Pricing
View Details