Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inclusion membrane protein A (incA)

This Recombinant Inclusion membrane protein A (incA) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Inclusion membrane protein A

UniProt

O69196

Expression Region

1-273

Origin

Chlamydia trachomatis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTPTLIVTPPSPPAPSYSANRVPQPSLMDKIKKIAAIASLILIGTIGFLALLGHLVGFL IAPQITIVLLALFITSLAGNALYLQKTANLHLYQDLQREVGSLKEINFMLSVLQKEFLHL SKEFATTSKDLSAVSQDFYSCLQGFRDNYKGFESLLDEYKNSTEEMRKLFSQEIIADLKS SVASLREEIRFLTPLAEEVRRLAHNRESLTAAIEELKTIRDSLRDEIGQLSQLSRTLTSQ IALQRKESSDLCSQIRETLSSPRKSASPSTKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Bright™ Violet 650 Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994U 50 Tests

Elab Bright™ Violet 650 Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details
Diphenyl Chlorophosphonate
TRC-D489470-50G 50 g

Diphenyl Chlorophosphonate

Sign In for Pricing
View Details
DCP1A Human Gene Knockout Kit (CRISPR)
KN401330 1 Kit

DCP1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pentyl Hexanoate
TRC-P570880-10MG 10 mg

Pentyl Hexanoate

Sign In for Pricing
View Details
Recombinant Human IL-22BP/IL22RA2 Protein (His & Fc Tag)
PKSH031301 50 µg

Recombinant Human IL-22BP/IL22RA2 Protein (His & Fc Tag)

Sign In for Pricing
View Details
CD33 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7G8]
TA806758AM 100 µL

CD33 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7G8]

Sign In for Pricing
View Details