Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein E8 (E8R)

This Recombinant Vaccinia virus Protein E8 (E8R) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Protein E8

UniProt

P21049

Expression Region

1-273

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATVPRFDDVYKNAQRRILDQETFFSRGLSRPLMKNTYLFDNYAYGWIPETAIWSSRYA NLDASDYYPISLGLLKKFEFLMSLYKGPIPVYEEKVNTEFIANGSFSGRYVSYLRKFSAL PTNEFISFLLLTSIPIYNILFWFKNTQFDITKHTLFRYVYTDNAKHLALARYMHQTGDYK PLFSRLKENYIFTGPVPICIKDIDHPNLSRARSPSDYETLANISTILYFTKYDPVLMFLL FYVPGYSITTKITPAVEYLMDKLNLTKSDVQLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P70 S6 kinase α Polyclonal Antibody
orb1412623 100 µL

P70 S6 kinase α Polyclonal Antibody

Sign In for Pricing
View Details
Q Sepharose Column
9081 5 mL

Q Sepharose Column

Sign In for Pricing
View Details
(S, R, R) -2- (2,2-Diphenyl-[1,3]dioxolan-4-yl) -piperidine
EAA79218-01 25 mg

(S, R, R) -2- (2,2-Diphenyl-[1,3]dioxolan-4-yl) -piperidine

Sign In for Pricing
View Details
(S, R, R) -2- (2,2-Diphenyl-[1,3]dioxolan-4-yl) -piperidine
EAA79218-02 50 mg

(S, R, R) -2- (2,2-Diphenyl-[1,3]dioxolan-4-yl) -piperidine

Sign In for Pricing
View Details
TXNRD3NB Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV804729 1.0 µg DNA

TXNRD3NB Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
4930502E18Rik 3'UTR GFP Stable Cell Line
TU150712 1.0 mL

4930502E18Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details