Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein E8 (E8R)

This Recombinant Vaccinia virus Protein E8 (E8R) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Protein E8

UniProt

P21049

Expression Region

1-273

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATVPRFDDVYKNAQRRILDQETFFSRGLSRPLMKNTYLFDNYAYGWIPETAIWSSRYA NLDASDYYPISLGLLKKFEFLMSLYKGPIPVYEEKVNTEFIANGSFSGRYVSYLRKFSAL PTNEFISFLLLTSIPIYNILFWFKNTQFDITKHTLFRYVYTDNAKHLALARYMHQTGDYK PLFSRLKENYIFTGPVPICIKDIDHPNLSRARSPSDYETLANISTILYFTKYDPVLMFLL FYVPGYSITTKITPAVEYLMDKLNLTKSDVQLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA4 (Homeobox A4, HOX1, HOX1D)
247192 50 µg

HOXA4 (Homeobox A4, HOX1, HOX1D)

Sign In for Pricing
View Details
GOLGA7 (Golgin Subfamily A Member 7, Golgin A7, GOLGA7A, GOLGA3AP1, Golgi Complex-associated Protein of 16kD, GCP16, HDCKB03P, HSPC041, MGC4876, MGC21096) (FITC)
127461-FITC 100 µL

GOLGA7 (Golgin Subfamily A Member 7, Golgin A7, GOLGA7A, GOLGA3AP1, Golgi Complex-associated Protein of 16kD, GCP16, HDCKB03P, HSPC041, MGC4876, MGC21096) (FITC)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Cysteine-rich repeat secretory protein 43 (CRRSP43)
MBS1140555-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Cysteine-rich repeat secretory protein 43 (CRRSP43)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Cysteine-rich repeat secretory protein 43 (CRRSP43)
MBS1140555-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Cysteine-rich repeat secretory protein 43 (CRRSP43)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Cysteine-rich repeat secretory protein 43 (CRRSP43)
MBS1140555-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Cysteine-rich repeat secretory protein 43 (CRRSP43)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Cysteine-rich repeat secretory protein 43 (CRRSP43)
MBS1140555-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Cysteine-rich repeat secretory protein 43 (CRRSP43)

Sign In for Pricing
View Details