Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SARS coronavirus Protein 3a (3a)

This Recombinant Human SARS coronavirus Protein 3a (3a) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Protein 3a, Accessory protein 3a, Protein U274, Protein X1

UniProt

P59632

Expression Region

1-274

Origin

Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSAT KIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINA CRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGISTPKL KEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDP PNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystatin C Recombinant Rabbit Monoclonal Antibody [JJ09-16]
ET1701-72 100 µL

Cystatin C Recombinant Rabbit Monoclonal Antibody [JJ09-16]

Sign In for Pricing
View Details
XYLT1 Human Gene Knockout Kit (CRISPR)
KN222133RB 1 Kit

XYLT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Secretory Leukocyte Peptidase Inhibitor (SLPI) ELISA Kit
RD-SLPI-Mu-01 96 Tests

Mouse Secretory Leukocyte Peptidase Inhibitor (SLPI) ELISA Kit

Sign In for Pricing
View Details
Mouse Secretory Leukocyte Peptidase Inhibitor (SLPI) ELISA Kit
RD-SLPI-Mu-02 48 Tests

Mouse Secretory Leukocyte Peptidase Inhibitor (SLPI) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS518402 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Spink6 Mouse Gene Knockout Kit (CRISPR)
KN516620 1 Kit

Spink6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details