Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SARS coronavirus Protein 3a (3a)

This Recombinant Human SARS coronavirus Protein 3a (3a) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Protein 3a, Accessory protein 3a, Protein U274, Protein X1

UniProt

P59632

Expression Region

1-274

Origin

Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSAT KIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINA CRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGISTPKL KEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDP PNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THOC3 (NM_032361) Human Over-expression Lysate
LY403157 100 µg

THOC3 (NM_032361) Human Over-expression Lysate

Sign In for Pricing
View Details
GSTP1 Antibody (Biotin)
KB-876-01 50 μL

GSTP1 Antibody (Biotin)

Sign In for Pricing
View Details
GSTP1 Antibody (Biotin)
KB-876-02 100 µL

GSTP1 Antibody (Biotin)

Sign In for Pricing
View Details
GSTP1 Antibody (Biotin)
KB-876-03 1 mL

GSTP1 Antibody (Biotin)

Sign In for Pricing
View Details
FADD (NM_003824) Human Over-expression Lysate
LC401265 20 µg

FADD (NM_003824) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216L-01 50 Tests

Elab Fluor® 488 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details