Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Propithecus coquereli Transmembrane O-methyltransferase (LRTOMT)

This Recombinant Propithecus coquereli Transmembrane O-methyltransferase (LRTOMT) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Transmembrane O-methyltransferase, EC= 2.1.1.6, Catechol O-methyltransferase 2, Protein LRTOMT2

UniProt

B6CZ56

Expression Region

1-274

Origin

Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTPWRKRKGITQVGTMSPAIALAFLPLVVTLLVRYRHYFRLLVGTVLLRSLRDCLSGLR IEERAFSYVLTHALPGDPGHILTTLDHWSSHCEYLSHMGPVKGQILMRLVEEKAPACVLE LGTYCGYSTLLIAQALPPGGRLLTVERDPRTAAVAEKLIRLAGFDEHMVELIVGSSEEVI PCLRTQYQLSRADLVLLIHRPRCYLRDLQLLEAHALLPAGATVLADHVLFPGAPRFLQYA KSCGRYRCRLYHTGLPDFPAIKDGIAQLTYAGPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GLTPD2 activation kit by CRISPRa
GA117940 1 Kit

Human GLTPD2 activation kit by CRISPRa

Sign In for Pricing
View Details
COLCA1 (NM_001302645) Human Tagged ORF Clone
RG235815 10 µg

COLCA1 (NM_001302645) Human Tagged ORF Clone

Sign In for Pricing
View Details
Met (Ab-1234) Antibody
8B7151-AAT 50 µg

Met (Ab-1234) Antibody

Sign In for Pricing
View Details
TNFSF13B Antibody
KC-3775-01 50 μL

TNFSF13B Antibody

Sign In for Pricing
View Details
TNFSF13B Antibody
KC-3775-02 100 µL

TNFSF13B Antibody

Sign In for Pricing
View Details
TNFSF13B Antibody
KC-3775-03 1 mL

TNFSF13B Antibody

Sign In for Pricing
View Details