Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Propithecus coquereli Transmembrane O-methyltransferase (LRTOMT)

This Recombinant Propithecus coquereli Transmembrane O-methyltransferase (LRTOMT) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Transmembrane O-methyltransferase, EC= 2.1.1.6, Catechol O-methyltransferase 2, Protein LRTOMT2

UniProt

B6CZ56

Expression Region

1-274

Origin

Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTPWRKRKGITQVGTMSPAIALAFLPLVVTLLVRYRHYFRLLVGTVLLRSLRDCLSGLR IEERAFSYVLTHALPGDPGHILTTLDHWSSHCEYLSHMGPVKGQILMRLVEEKAPACVLE LGTYCGYSTLLIAQALPPGGRLLTVERDPRTAAVAEKLIRLAGFDEHMVELIVGSSEEVI PCLRTQYQLSRADLVLLIHRPRCYLRDLQLLEAHALLPAGATVLADHVLFPGAPRFLQYA KSCGRYRCRLYHTGLPDFPAIKDGIAQLTYAGPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT10 (PRMT9) (NM_138364) Human Recombinant Protein
TP309584M 100 µg

PRMT10 (PRMT9) (NM_138364) Human Recombinant Protein

Sign In for Pricing
View Details
Sphingomyelin Synthase 2 (SGMS2) Rabbit Polyclonal Antibody
AP05208PU-N 100 µg

Sphingomyelin Synthase 2 (SGMS2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LIPI Antibody
8C16481-AAT 50 µg

LIPI Antibody

Sign In for Pricing
View Details
Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF640R conjugate, 0.1mg/mL
BNC401600-100 1x 100 µL

Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PF4V1 Human Gene Knockout Kit (CRISPR)
KN420116 1 Kit

PF4V1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 647 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09742M-01 20 Tests

Elab Fluor® 647 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details