Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus Rp3/2004 Protein 3 (3)

This Recombinant Bat coronavirus Rp3/2004 Protein 3 (3) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Protein 3, Accessory protein 3

UniProt

Q3I5J4

Expression Region

1-274

Origin

Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLFMSIFTLGAITRQPAKIENASPASTVHATATIPLQASLPFGWLVVGVALLAVFQSAS KVIALHKRWQLALHKGIQLVCNLLLLFVTIYSHLLLLAAGMEAQFLYIYALIYILQIVSF CRFIMRCWLCWKCRSKNPLLYDANYFVCWHTNCFDYCIPYNSITDTIVLTSGDGTTQPKL KEDYQIGGYSEDWHSGVKDYVVIHGYFTEVYYQLESTQLSTDTGAENATFFIYSKLVKDV DHVQIHTIDGSSGVVNPAMDPIYDEPTTTTSVPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Nucleocapsid Protein
PKSV030309-01 50 µg

Recombinant SARS-CoV-2 Nucleocapsid Protein

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Nucleocapsid Protein
PKSV030309-02 500 µg

Recombinant SARS-CoV-2 Nucleocapsid Protein

Sign In for Pricing
View Details
6-Chloro D-Tryptophan
TRC-C423200-5MG 5 mg

6-Chloro D-Tryptophan

Sign In for Pricing
View Details
ETS1 / (Marker of Tumor Metastasis) (ETS1/1282), CF594 conjugate, 0.1mg/mL
BNC941282-100 1x 100 µL

ETS1 / (Marker of Tumor Metastasis) (ETS1/1282), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor V (F5) Rabbit Polyclonal Antibody
TA372533 100 µL

Factor V (F5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit
E-EL-M3071-01 24 Tests

Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details