Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus Rp3/2004 Protein 3 (3)

This Recombinant Bat coronavirus Rp3/2004 Protein 3 (3) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Protein 3, Accessory protein 3

UniProt

Q3I5J4

Expression Region

1-274

Origin

Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLFMSIFTLGAITRQPAKIENASPASTVHATATIPLQASLPFGWLVVGVALLAVFQSAS KVIALHKRWQLALHKGIQLVCNLLLLFVTIYSHLLLLAAGMEAQFLYIYALIYILQIVSF CRFIMRCWLCWKCRSKNPLLYDANYFVCWHTNCFDYCIPYNSITDTIVLTSGDGTTQPKL KEDYQIGGYSEDWHSGVKDYVVIHGYFTEVYYQLESTQLSTDTGAENATFFIYSKLVKDV DHVQIHTIDGSSGVVNPAMDPIYDEPTTTTSVPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ddr1 Mouse Gene Knockout Kit (CRISPR)
KN304371RB 1 Kit

Ddr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant APG5L Antibody
RC-4092-01 50 μL

Recombinant APG5L Antibody

Sign In for Pricing
View Details
Recombinant APG5L Antibody
RC-4092-02 100 µL

Recombinant APG5L Antibody

Sign In for Pricing
View Details
Recombinant APG5L Antibody
RC-4092-03 1 mL

Recombinant APG5L Antibody

Sign In for Pricing
View Details
Recombinant DNA Polymerase beta Antibody
RC-16911-01 50 μL

Recombinant DNA Polymerase beta Antibody

Sign In for Pricing
View Details
Recombinant DNA Polymerase beta Antibody
RC-16911-02 100 µL

Recombinant DNA Polymerase beta Antibody

Sign In for Pricing
View Details