Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus Rp3/2004 Protein 3 (3)

This Recombinant Bat coronavirus Rp3/2004 Protein 3 (3) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Protein 3, Accessory protein 3

UniProt

Q3I5J4

Expression Region

1-274

Origin

Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLFMSIFTLGAITRQPAKIENASPASTVHATATIPLQASLPFGWLVVGVALLAVFQSAS KVIALHKRWQLALHKGIQLVCNLLLLFVTIYSHLLLLAAGMEAQFLYIYALIYILQIVSF CRFIMRCWLCWKCRSKNPLLYDANYFVCWHTNCFDYCIPYNSITDTIVLTSGDGTTQPKL KEDYQIGGYSEDWHSGVKDYVVIHGYFTEVYYQLESTQLSTDTGAENATFFIYSKLVKDV DHVQIHTIDGSSGVVNPAMDPIYDEPTTTTSVPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAR (PTPRF) Human Gene Knockout Kit (CRISPR)
KN207873 1 Kit

LAR (PTPRF) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C8orf48 activation kit by CRISPRa
GA115933 1 Kit

Human C8orf48 activation kit by CRISPRa

Sign In for Pricing
View Details
NAPSIN A Recombinant Rabbit Monoclonal Antibody [PD01-30]
HA721218 100 µL

NAPSIN A Recombinant Rabbit Monoclonal Antibody [PD01-30]

Sign In for Pricing
View Details
Kappa Light Chain (TB28-2), CF488A conjugate, 0.1mg/mL
BNC880708-500 1x 500 µL

Kappa Light Chain (TB28-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-Amino-2-bromobenzoic Acid
TRC-A602490-5G 5 g

5-Amino-2-bromobenzoic Acid

Sign In for Pricing
View Details
KANK3 (NM_198471) Human Over-expression Lysate
LY403679 100 µg

KANK3 (NM_198471) Human Over-expression Lysate

Sign In for Pricing
View Details