Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Protein FAM210A (FAM210A)

This Recombinant Chicken Protein FAM210A (FAM210A) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Protein FAM210A

UniProt

Q5ZML6

Expression Region

1-275

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRSVLHTASQLAHGMCLLFPRTGAFRGLKGPSVSSNVGCKVILALDPPKRCLHAGAALF ASKSSAVSSQPADTPRKVPEEREPLTSATEVPKQSPVESDASDPDPLQDKSISLVQRFKK TFKQYGKVMIPVHLVTSTVWFGSFYYAAMKGVNVVPFLELIGLPDSIVDILKNSQSGNAL TAYALYKIATPARYTVTLGGTSITVKYLRKNGYMSTPPPVKEYLQDRMEETKDKITEKME ETKDKITEKMEETKDKITEKIQETKDKVSFKKIKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-100 1x 100 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF488A conjugate, 0.1mg/mL
BNC882884-500 1x 500 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3/863), CF405S conjugate, 0.1mg/mL
BNC040863-500 1x 500 µL

Glypican-3 (GPC3/863), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details