Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C17orf78 (C17orf78)

This Recombinant Human Uncharacterized protein C17orf78 (C17orf78) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Uncharacterized protein C17orf78

UniProt

Q8N4C9

Expression Region

1-275

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTILVFSLIIASYDANKKDLRDSSCRLEQLPGIFPKDVRSIRELQMQETHTETKRTTFI QNRTIATLQCLGSDSKVKVNLVYLERRPKVKHILKNLRIIAAPRRNSSASSSCHLIPTSK FQTGSLLKGKAFLPGISQCKVLGASSETFPTTAPSITPGNKEGEKTTSTDTDENLEKRQK WSIVVKILIAVTLLLSGVAIIVFVIFEVPCPYQCLGARKLCQCQWLWRWQKKGGQPPGTA ESKPDSQPQKVGQDAANSSNPKKAAEITVIHQTYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MALT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D2]
TA807322AM 100 µL

MALT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D2]

Sign In for Pricing
View Details
p114RhoGEF (ARHGEF18) (C-term) Goat Polyclonal Antibody
AP31062PU-N 100 µg

p114RhoGEF (ARHGEF18) (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Purified Anti-Human TCRVβ1 Antibody[BL37.2]
AN003710P-01 25 µg

Purified Anti-Human TCRVβ1 Antibody[BL37.2]

Sign In for Pricing
View Details
Purified Anti-Human TCRVβ1 Antibody[BL37.2]
AN003710P-02 100 µg

Purified Anti-Human TCRVβ1 Antibody[BL37.2]

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF405S conjugate, 0.1mg/mL
BNC041983-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FKRP Rabbit Polyclonal Antibody
TA376268 100 µL

FKRP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details